DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG11037

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:96/224 - (42%) Gaps:37/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 WVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTS---TTADQQHVDL 102
            ::.::|.:.|    ::..|:|:|.|:||||||...|..|      |.||..:   :..:|:.:..
  Fly    76 YLTALLYEDD----FVCGGTLLNENIVLTAAHCFLGRMK------ASEWIVAAGISNLNQKGIRR 130

  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVYLNS 166
            .|.:.:..|||...:...::|:::|.:..:..   |:..|.|....::.| ....:|||......
  Fly   131 HVKDFILSEQFREDDMNMDVAVVLLKTPLKAK---NIGTLSLCSVSLKPGVELVVSGWGMTAPRG 192

  Fly   167 TDYPTVLKTVQVDLLSMGMC-----SSRKLPIQQICGKGLEGID-CSGDGGAPL-----VCRILT 220
            .....:|:||.|.::....|     .:.|:....||...|...| |:.|.|.||     ||.|::
  Fly   193 RGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACTFDSGGPLVFKKQVCGIVS 257

  Fly   221 ---------YPYKYAQVGIVNWLSQKPVE 240
                     ||..|..|..|....:|.::
  Fly   258 FGIGCASNRYPGVYTDVMYVKPFIEKSIK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 55/224 (25%)
Tryp_SPc 39..256 CDD:214473 55/224 (25%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 54/217 (25%)
Tryp_SPc 62..283 CDD:238113 54/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.