DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG4613

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:257 Identity:67/257 - (26%)
Similarity:108/257 - (42%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IRRETYGSNPRAT-FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEW 89
            :.|...|:..|.. :||:..::   ...|.:.| |:|||...||||||.::|.....:.||..:.
  Fly   134 VNRIVGGTQVRTNKYPWIAQII---RGTFLFCG-GTLINDRYVLTAAHCVHGMDMRGVSVRLLQL 194

  Fly    90 DTSTTADQQH--VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANIN---LIPLYLQEAGI 149
            |.|:|    |  |...|....:|..::..:..:::|||.|.....:...:.   |...:||....
  Fly   195 DRSST----HLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDF 255

  Fly   150 QKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC---SSRKLPIQQICGKG---LEGID-CS 207
            ||  ....||| :........:||:.|.|.:::...|   |.|.:.:..:...|   ..|.| |.
  Fly   256 QK--AIVAGWG-LSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQ 317

  Fly   208 GDGGAPLVCR--------ILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            ||.|.||:.|        ::::.|..|          ||  :...|:|.|:..|.||..:.|
  Fly   318 GDSGGPLIVRDRIFRLAGVVSFGYGCA----------KP--DAPGVYTRVSRYLEWIAVNTR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 63/239 (26%)
Tryp_SPc 39..256 CDD:214473 61/236 (26%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 64/248 (26%)
Tryp_SPc 137..362 CDD:238113 63/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.