DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG10663

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:233 Identity:67/233 - (28%)
Similarity:104/233 - (44%) Gaps:24/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RATFPWVVSVLDQRDWLFR--YIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQ 98
            :..:||.|::|::    |:  :.| |:||.|..||||||.:...    |.||.||.:.: ..|..
  Fly   515 KGEWPWQVAILNR----FKEAFCG-GTLIAPRWVLTAAHCVRKV----LFVRIGEHNLN-YEDGT 569

  Fly    99 HVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKV 162
            .:.|.|:...:|..|::...::::|||.|..|...|..|....|......:.|. .|...||||.
  Fly   570 EIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKR 634

  Fly   163 YLNSTDYPTVLKTVQVDLLSMGMCSSRK------LPIQQICGKGLEG-ID-CSGDGGAPLVCRIL 219
            ........:||....|.::.|..|  ||      :.....|....:| || |:||.|.||:||..
  Fly   635 RNRDATGTSVLHKATVPIIPMQNC--RKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDT 697

  Fly   220 TYP-YKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            |.| :.:...||.::.......|.|.::..|...:.|:
  Fly   698 TKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 67/230 (29%)
Tryp_SPc 39..256 CDD:214473 66/228 (29%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 66/231 (29%)
Tryp_SPc 507..735 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.