DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG32374

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:268 Identity:58/268 - (21%)
Similarity:97/268 - (36%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQYFNYN--QIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGS-------------------- 60
            :.|..|.  :|:.:|:.....:|.| .::.|:.:|:|...|..|.                    
  Fly    35 THYLLYEGPRIKPQTFLPGNISTNP-AINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFI 98

  Fly    61 ----LINPNVVLTAAHILNGTT-KYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAEN 120
                ::|...:|||.|...|.. :|  .||||..........:||.    ..|.|..::.:..:|
  Fly    99 CGCVILNRRWILTAQHCKIGNPGRY--TVRAGSTQQRRGGQLRHVQ----KTVCHPNYSEYTMKN 157

  Fly   121 NMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFF-NGWGKVYLNSTDYPTVLKTVQVDLLSMG 184
            ::.::.|.:...:...:..:.|...... :...|:. :|||....|:.:....|:.|.|..:|..
  Fly   158 DLCMMKLKTPLNVGRCVQKVKLPSTRTK-RFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRA 221

  Fly   185 MC------SSRKLPIQQICGKGLEGIDCSGDGGAPLV--------------CRILTYPYKYAQV- 228
            .|      :..|:..|.||.|......||||.|.|||              |....||..|..| 
  Fly   222 KCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVL 286

  Fly   229 GIVNWLSQ 236
            ....|:.:
  Fly   287 QYTRWIKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 53/245 (22%)
Tryp_SPc 39..256 CDD:214473 53/245 (22%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 48/225 (21%)
Tryp_SPc 74..295 CDD:238113 49/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.