DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG16998

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:223 Identity:60/223 - (26%)
Similarity:94/223 - (42%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEV 104
            ||:.|:....:    |....:||....::||.|.:.....|.  ||||    ||..|.......|
  Fly    37 PWLASITVHGN----YSCSSALITSLWLVTAGHCVQYPDSYS--VRAG----STFTDGGGQRRNV 91

  Fly   105 LNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDY 169
            ::::.|..||....||::|||.|..:|.:..||.::.|.|....|...:....|||......::.
  Fly    92 VSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRTLLVAGWGNPDATDSES 156

  Fly   170 PTVLKTVQVDLLSMGMCS------SRKLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKYAQV 228
            ...|:...|.:::..:|.      .|.:....:|..|.....|.||.|||||.|..:|       
  Fly   157 EPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAGRDHCYGDSGAPLVHRGSSY------- 214

  Fly   229 GIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            |||::.......:...|:|.:|..:.||
  Fly   215 GIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 60/223 (27%)
Tryp_SPc 39..256 CDD:214473 58/221 (26%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 58/221 (26%)
Tryp_SPc 25..242 CDD:238113 58/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.