DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and mas

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:301 Identity:71/301 - (23%)
Similarity:111/301 - (36%) Gaps:70/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVNSQYFNYNQIR----RETYGSNPRATFP----------------------------------- 40
            ||.|.....||:|    .:.....|...:|                                   
  Fly   751 LVESSSLQSNQLRSYHNHQAQADQPDLVYPEYYQQRSLYGLQSNFSGRRRARVVGGEDGENGEWC 815

  Fly    41 WVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYD--LVVRAGEWD-TSTTADQQHVDL 102
            |.|::::.   |.:|:...:||....||||||.:....:..  :.||.|::| |..........|
  Fly   816 WQVALINS---LNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLTRKYGSPGAQTL 877

  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGS-CFFNGWGKVYLNS 166
            .|.....|...|....:|::|||.|....|:...:.|:.|..:......|. |...|:|  |:..
  Fly   878 RVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKRCTVTGYG--YMGE 940

  Fly   167 T-DYPTVLKTVQVDLLSMGMCSSRK----------LPIQQICGKGLEGID-CSGDGGAPLVCRIL 219
            . ..|..::..::.::|...| .||          ||....|..|.||.| |.||||.||||:..
  Fly   941 AGPIPLRVREAEIPIVSDTEC-IRKVNAVTEKIFILPASSFCAGGEEGHDACQGDGGGPLVCQDD 1004

  Fly   220 TYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAGLLPWID 257
            .:   |...|:|:|   ..::.|..   |:...:..:.||:
  Fly  1005 GF---YELAGLVSWGFGCGRQDVPG---VYVKTSSFIGWIN 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/273 (23%)
Tryp_SPc 39..256 CDD:214473 62/270 (23%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.