DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG14990

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:242 Identity:90/242 - (37%)
Similarity:123/242 - (50%) Gaps:16/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTAD-QQHVDL 102
            |||||::..|.    :|.|.||||.|.||||||.|:.|.|..::|||||||:|...:: ....|.
  Fly    72 FPWVVALFSQG----KYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDR 132

  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNST 167
            .|..:|.|.:|:.....||:|||.|.:.||:.::|..|.|..|.....:..|...|||||..|..
  Fly   133 PVARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDE 197

  Fly   168 DYPTVLKTVQVDLLSMGMCS----------SRKLPIQQICGKG-LEGIDCSGDGGAPLVCRILTY 221
            :|..:.|.:::.:::...|.          |..||...||..| .:..||.||||:.|.|.:...
  Fly   198 NYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEAD 262

  Fly   222 PYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLRLEANFRP 268
            |.:|.|.|||||......||...|:|||.....||..|:...:|..|
  Fly   263 PSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSNSVP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 87/231 (38%)
Tryp_SPc 39..256 CDD:214473 85/228 (37%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 87/231 (38%)
Tryp_SPc 67..297 CDD:214473 85/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.