DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and KLKB1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:272 Identity:65/272 - (23%)
Similarity:108/272 - (39%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TTLIISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHI 73
            :|.|:...||.:                ..:||.|| |..:....|::..||||....||||||.
Human   399 STRIVGGTNSSW----------------GEWPWQVS-LQVKLTAQRHLCGGSLIGHQWVLTAAHC 446

  Fly    74 LNGTTKYDL------VVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFE 132
            .:|....|:      ::...:....|...|      :..|:.|:.:......:::||:      :
Human   447 FDGLPLQDVWRIYSGILNLSDITKDTPFSQ------IKEIIIHQNYKVSEGNHDIALI------K 499

  Fly   133 MTANINLI----PLYLQEAGIQK---GSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR- 189
            :.|.:|..    |:.|...|...   .:|:..||| ......:...:|:.|.:.|::...|..| 
Human   500 LQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWG-FSKEKGEIQNILQKVNIPLVTNEECQKRY 563

  Fly   190 ---KLPIQQICGKGLEG--IDCSGDGGAPLVCRILTYPYKYAQVGIVNW-----LSQKPVENTFI 244
               |:..:.:|....||  ..|.||.|.||||:   :...:..|||.:|     ..::|.     
Human   564 QDYKITQRMVCAGYKEGGKDACKGDSGGPLVCK---HNGMWRLVGITSWGEGCARREQPG----- 620

  Fly   245 VFTNVAGLLPWI 256
            |:|.||..:.||
Human   621 VYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 61/242 (25%)
Tryp_SPc 39..256 CDD:214473 59/240 (25%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 401..632 CDD:214473 62/268 (23%)
Tryp_SPc 402..632 CDD:238113 62/267 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.