DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG9294

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:267 Identity:73/267 - (27%)
Similarity:107/267 - (40%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVNSQYFNYNQIRRETYGSNPRA-TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTT 78
            |:|:.|       :...|...|. .:||:..:|...    |:...|||||...||||||.:.|..
  Fly    94 LINTLY-------KIVGGQETRVHQYPWMAVILIYN----RFYCSGSLINDLYVLTAAHCVEGVP 147

  Fly    79 KYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLY 143
            ...:.:|..|.:.|.:.|...:...|..:..||.:|..:.:|::|:|.|....:|..: .|.|:.
  Fly   148 PELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHH-RLRPIC 211

  Fly   144 L--------QEAGIQKGSCFFNGWGKVYLN--STDYPTVLKTVQVDLLSMGMCSS------RKLP 192
            |        .|.||      ..|||.....  .||   .|:.|.|.:|....|.:      .::.
  Fly   212 LPVQSYSFDHELGI------VAGWGAQREGGFGTD---TLREVDVVVLPQSECRNGTTYRPGQIT 267

  Fly   193 IQQICGKGLE--GID-CSGDGGAPLVCRILTYPYKYAQVGIVNW-----LSQKPVENTFIVFTNV 249
            ...:|...:.  |.| ||||.|.||.......|.:|...|||:|     ..|.|.     |:|.|
  Fly   268 DNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPG-----VYTRV 327

  Fly   250 AGLLPWI 256
            ...|.|:
  Fly   328 NQYLRWL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/242 (28%)
Tryp_SPc 39..256 CDD:214473 67/240 (28%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 69/251 (27%)
Tryp_SPc 101..334 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.