DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and tpr

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:206 Identity:64/206 - (31%)
Similarity:100/206 - (48%) Gaps:23/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLE 103
            :|||..:|    :..|:....||:|...:|||:|.:.|..|..:.||..|.|.. .:..|.:|.:
  Fly   138 YPWVAMLL----YGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRK-MSHMQKIDRK 197

  Fly   104 VLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQ-KG-SCFFNGWGKVYLNS 166
            |..:::|.::|..|.:|::|::.|....|.  |..|.|:.:...|.. || :....|||.:.:..
  Fly   198 VAEVITHPKYNARNYDNDIAIIKLDEPVEF--NEVLHPVCMPTPGRSFKGENGIVTGWGALKVGG 260

  Fly   167 TDYPT--VLKTVQVDLLSMGMC-SSR---KLPIQQICGKGLEG--IDCSGDGGAPLVCRILTYPY 223
               ||  .|:.|||.:||...| .||   |:....:||...||  ..|.||.|.||  .|:....
  Fly   261 ---PTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPL--HIVASGT 320

  Fly   224 KYAQV-GIVNW 233
            :..|: |:|:|
  Fly   321 REHQIAGVVSW 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/206 (31%)
Tryp_SPc 39..256 CDD:214473 64/206 (31%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 64/206 (31%)
Tryp_SPc 127..356 CDD:238113 64/206 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.