DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG11192

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:241 Identity:74/241 - (30%)
Similarity:101/241 - (41%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGT-TKYDLVVRAGEWDTSTTADQQHVDL 102
            ||:.|||..|.    |:|..|::|..:.||||||..... :..|..||.|   :|......|| |
  Fly    39 FPYQVSVQLQG----RHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVG---SSEHESGGHV-L 95

  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPL-YLQEAGIQKGSCFFNGWG-----K 161
            .:..:::|..:|..:.:|::|||||......|.::..:|| .|.:..........:|||     .
  Fly    96 SLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEES 160

  Fly   162 VYLNSTDYPTVLKTVQVDLLSMGMCS---SRKLPI--QQICGKGLEGIDCSGDGGAPLVCRILTY 221
            ...........|:.|.|||:....|.   |:.|||  :.||........|.||.|.|||      
  Fly   161 AVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARPGRDSCQGDSGGPLV------ 219

  Fly   222 PYKYAQ-------VGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHL 260
              .||.       .|||:|.......|...|:||||....|||..|
  Fly   220 --GYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 73/238 (31%)
Tryp_SPc 39..256 CDD:214473 70/235 (30%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 70/235 (30%)
Tryp_SPc 28..262 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.