DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG8299

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:232 Identity:67/232 - (28%)
Similarity:110/232 - (47%) Gaps:26/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVR--AGEWDTSTTADQQH 99
            |.||:.|||..:...|....| ||:..|.||:||||.:.|  :|...:|  ||:   ::.||.:.
  Fly    37 ADFPYQVSVRLETYMLLHICG-GSIYAPRVVITAAHCIKG--RYASYIRIVAGQ---NSIADLEE 95

  Fly   100 VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYL 164
            ..::|..::.|..:|:....|::.|:|.....|.:|.:..|.:.| ||.........:||||...
  Fly    96 QGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVAL-EAPPSGAQAVVSGWGKRAE 159

  Fly   165 NSTDYPTVLKTVQVDLLSMGMCSSRKL------PIQQICGKGLEG--IDCSGDGGAPL-VCRILT 220
            :....|.:|:.|::.::....|.::.|      ..:.:|...|||  ..|:||.|.|| |..:| 
  Fly   160 DDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVL- 223

  Fly   221 YPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWID 257
                   ||:|:|......|....|:|:|...:.||:
  Fly   224 -------VGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 66/230 (29%)
Tryp_SPc 39..256 CDD:214473 64/227 (28%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 65/229 (28%)
Tryp_SPc 28..255 CDD:238113 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.