DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG13744

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:264 Identity:69/264 - (26%)
Similarity:113/264 - (42%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NQIRRETYGSNPR--ATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRA 86
            |.:::...|..|.  |.:||...:.     :..|...|.||:.|:|.||||.:......|:.|..
  Fly   136 NTLQKRIIGGRPAQFAEYPWQAHIR-----IAEYQCGGVLISANMVATAAHCIQQAHLADITVYL 195

  Fly    87 GEWDTSTTADQQHV----DLE---VLNIVSHEQFN-------RFNAENNMALLILVSAFEMTANI 137
            ||.||.   |..|:    .:|   ||..:.|.:||       |:    ::|||.|......|.:|
  Fly   196 GELDTQ---DLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRY----DIALLKLAQPTSFTEHI 253

  Fly   138 NLIPLYLQEAGI----QKGSCFFNGWGKVYLNSTDYPT-VLKTVQVDLLSMGMC----SSRKLPI 193
              :|:.|.:..|    :||  ...||||...:.....| :|:...|.:::...|    .|:::.:
  Fly   254 --LPICLPQYPIRLIGRKG--LIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINV 314

  Fly   194 ----QQICGKGLEG-ID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGL 252
                :..|....:| :| |.||.|.|||   :....::..|||.:......|::...::.||...
  Fly   315 EIKAEMFCAGHSDGHMDACLGDSGGPLV---IKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKT 376

  Fly   253 LPWI 256
            :.||
  Fly   377 VRWI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 65/247 (26%)
Tryp_SPc 39..256 CDD:214473 63/245 (26%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 66/257 (26%)
Tryp_SPc 142..383 CDD:238113 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.