DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG8172

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:245 Identity:63/245 - (25%)
Similarity:113/245 - (46%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YGSNPRATFPWVVSVLDQRDWLFRYIGV-GSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTT 94
            :||:     ||.|::: :..:|.|.:.. |:||:...|:||||.:..|...::.:|.||||....
  Fly   324 FGSH-----PWQVALI-KSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQ 382

  Fly    95 ADQ-QHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANI----NLIPLYL--QEAGIQKG 152
            .:: .|.:..:.....|..:|..:..|::||:      .:..|:    ::||:.|  ....:...
  Fly   383 EERLNHEEYGIERKEVHPHYNPADFVNDVALI------RLDRNVVYKQHIIPVCLPPSTTKLTGK 441

  Fly   153 SCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC------SSRKLPIQQI--CGKGLEG--IDCS 207
            .....|||:.....:..|:||:.|.|:::|...|      :.|:..|..:  |....:|  ..|.
  Fly   442 MATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQ 506

  Fly   208 GDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWID 257
            ||.|.||.   ||...:...:|:|:|......|:...|:||:...:|||:
  Fly   507 GDSGGPLT---LTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWIN 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 61/237 (26%)
Tryp_SPc 39..256 CDD:214473 59/234 (25%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 61/242 (25%)
Tryp_SPc 316..555 CDD:238113 63/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.