DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG30371

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:298 Identity:63/298 - (21%)
Similarity:118/298 - (39%) Gaps:70/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYFAFLTT---------LIISLVNSQYFNYNQIRRETYGSNPRAT-FPWVVSVLDQRDWLFRYIG 57
            |.||:::|         .:.::..:....::...|...|....|. ||.:.::.|.......:.|
  Fly   115 LVFAYISTGTKGGSFKCTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASFCG 179

  Fly    58 VGSLINPNVVLTAAHILNGTTK-YDLVVRAGEWDT-STTADQQHVDLEVLNIVSHEQF-NRFNAE 119
             |:::....:|||||.:...:: .::|...|..|. :.::.:.:....:..::.|||: :..:..
  Fly   180 -GTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN 243

  Fly   120 NNMALLILVSAFEMTANINLIPLYLQEAG------------IQKGSCFFNG-----WGKVYLN-- 165
            |::|:||..|..:.:..:.  |:.|...|            |..|:.||.|     ..|:.||  
  Fly   244 NDIAVLITASNIQWSRGVG--PICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVV 306

  Fly   166 -----STDYPTVLKTVQVDLLSMGMCSSRKLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKY 225
                 .|:|..|     ..:.:..||:      ....|.|.:  .|..|.|.|::.|      |.
  Fly   307 TNQDCQTEYNNV-----ATIYTGQMCT------YDYSGTGRD--SCQFDSGGPVILR------KS 352

  Fly   226 AQ--VGIVNW-----LSQKPVENTFIVFTNVAGLLPWI 256
            .|  |||:::     .||.|:.    |.|.:...:.||
  Fly   353 RQFLVGIISYGKSCAESQYPMG----VNTRITSYISWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 56/252 (22%)
Tryp_SPc 39..256 CDD:214473 54/250 (22%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 57/262 (22%)
Tryp_SPc 150..389 CDD:238113 58/263 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.