DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss21

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:261 Identity:71/261 - (27%)
Similarity:109/261 - (41%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHIL-NGTTKYDLVVRAGE-------WDTSTTA 95
            :||..|:   |.|.....| .:|:|...||||||.. .....:|..|:.||       |:....:
  Rat    69 WPWQGSL---RVWGNHLCG-ATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLWNLQAYS 129

  Fly    96 DQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQ---KGSCFFN 157
            ::..::...|:....|||     .:::|||.|.|  .:|.:..:.|:.|..:..:   :..|:..
  Rat   130 NRYQIEDIFLSPKYTEQF-----PHDIALLKLSS--PVTYSNFIQPICLLNSTYKFANRTDCWVT 187

  Fly   158 GWGKVYLN-STDYPTVLKTVQVDLLSMGMCSSR-KLPI-------QQICGKGLEG--IDC----- 206
            |||.:..: |...|..|:.|||.:::..||:.. |.|.       ..:|....||  ..|     
  Rat   188 GWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIWGDMVCAGSPEGGKDACFAKLT 252

  Fly   207 ----SGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLRLEANFR 267
                .||.|.||||...|..|   |||:|:|.......|...|:||::....||...:......|
  Rat   253 YAAPQGDSGGPLVCNQDTVWY---QVGVVSWGIGCGRPNRPGVYTNISHHYNWIRLTMIRNGMLR 314

  Fly   268 P 268
            |
  Rat   315 P 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/250 (28%)
Tryp_SPc 39..256 CDD:214473 67/247 (27%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 67/247 (27%)
Tryp_SPc 58..304 CDD:238113 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.