DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG18563

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:237 Identity:70/237 - (29%)
Similarity:112/237 - (47%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAH-ILNGTTKYDLVVRAGEWDTSTTADQ 97
            |....:.|||::..:.    .|:..||||:|.|:||||| .:|...:..:||||||:..:||.:.
  Fly   140 NTTGLYSWVVALFYEE----VYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEP 200

  Fly    98 -QHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGK 161
             |:.:..|..||.||.|...:..||:||:.:.:.|.:...|.::.|..::|..:...|...||..
  Fly   201 IQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDL 265

  Fly   162 VYLNSTDYPTVLKTVQVDLLSMGMCSSR----------KLPIQQICGKGLEGID-CSGDGGAPLV 215
            |..:......::|.:::.:|....|.::          .|....||.:.....| |.|.||..|.
  Fly   266 VSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALF 330

  Fly   216 CRI-LTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            |.: ...|:.:.|.|||.|.....::...| :||||....||
  Fly   331 CSLGDENPHVFEQAGIVAWGMGCGLDLPGI-YTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/232 (30%)
Tryp_SPc 39..256 CDD:214473 67/230 (29%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 69/230 (30%)
Tryp_SPc 147..371 CDD:214473 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.