DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG4793

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:254 Identity:85/254 - (33%)
Similarity:125/254 - (49%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAA-HILNGTTKYDLVVRAGEWD-TSTTADQQ 98
            :...||:|::||.|..|  .:|.||||..:||||:: ..|....|| |:||||||| .|.|.::.
  Fly   107 KGELPWMVALLDSRSRL--PLGGGSLITRDVVLTSSTKTLEVPEKY-LIVRAGEWDFESITEERA 168

  Fly    99 HVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVY 163
            |.|:.:..||.|...:..|..||.|||.|....::..:|.||.|...........|..:||||..
  Fly   169 HEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRCIVSGWGKKT 233

  Fly   164 LNSTDYPTVLKTVQVDLLSMGMCSSRK---------LPIQQICGKGLEGID-CSGDGGAPLVCRI 218
            .....|..:||.:::.|:...:|.::.         |....||..|..|.| |.|||||||.|.:
  Fly   234 ALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPL 298

  Fly   219 LTYPYKYAQVGIVNWLSQKPVENTF-------IVFTNVAGLLPWIDYHLRLEA-NFRPR 269
            .:.|.:|..:||||:        .|       ..:|:|:.:..|||..::.|| ::.|:
  Fly   299 QSDPNRYELLGIVNF--------GFGCGGPLPAAYTDVSQIRSWIDNCIQAEAVHYSPQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 82/238 (34%)
Tryp_SPc 39..256 CDD:214473 79/235 (34%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 81/240 (34%)
Tryp_SPc 105..335 CDD:214473 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471523
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.