DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG9377

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:246 Identity:56/246 - (22%)
Similarity:102/246 - (41%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTAD-QQHVDL 102
            |||:|:|....    .|:..|:||.|..|:|.||.:..:....:.:.|||||.:...: |.|...
  Fly   112 FPWLVAVYGSD----TYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQR 172

  Fly   103 EVLNIVSHEQFNRFNAENNMALLIL--VSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLN 165
            .|:..:.|..:.:....:|:|:|::  ...|::..|:..|.|...........|:.:||.:    
  Fly   173 SVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCYVSGWQR---- 233

  Fly   166 STDY----------------PTVLKT-VQVDLLSMGMCSSRKLPIQQICGKGLEGIDCSGD---G 210
             :|:                |...:| :::.||......:..|    :|..|.:|....||   .
  Fly   234 -SDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSL----LCAGGDKGDFVCGDVDMT 293

  Fly   211 GAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            ..||:|.:..:..::...|::...::........::|||.....|||..||
  Fly   294 AVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWIDLKLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 54/242 (22%)
Tryp_SPc 39..256 CDD:214473 51/239 (21%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 52/240 (22%)
Tryp_SPc 105..339 CDD:214473 51/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.