DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and PRSS48

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:244 Identity:71/244 - (29%)
Similarity:106/244 - (43%) Gaps:44/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSV-LDQRDWLFRYIGVGSLINPNVVLTAAHILNGT-TKYDLVVRAGEWDTSTTA--DQQH 99
            :||.||: .|.     .:|..|||::..::|||||.:..| |.:...|    |..|.|.  .::.
Human    62 WPWQVSLHFDH-----NFICGGSLVSERLILTAAHCIQPTWTTFSYTV----WLGSITVGDSRKR 117

  Fly   100 VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG---SCFFNGWGK 161
            |...|..||.|.::....|:  :|||.|.|....|:.|  :|:.|.....|..   .|:..||||
Human   118 VKYYVSKIVIHPKYQDTTAD--VALLKLSSQVTFTSAI--LPICLPSVTKQLAIPPFCWVTGWGK 178

  Fly   162 VYLNS-TDYPTVLKTVQVDLLSMGMCSSRKLPI-------------QQICGKGLEGI--DCSGDG 210
            |..:| .||.:.|:..:|.::....|.....||             .:||....:.:  .|.||.
Human   179 VKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDS 243

  Fly   211 GAPLVCRILTYPYKYAQVGIVNWLSQ--KPVENTFIVFTNVAGLLPWID 257
            |.||.|.|   ...:.|.|:|:|..:  |.:..   |:|||.....||:
Human   244 GGPLSCHI---DGVWIQTGVVSWGLECGKSLPG---VYTNVIYYQKWIN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 71/244 (29%)
Tryp_SPc 39..256 CDD:214473 69/241 (29%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 69/241 (29%)
Tryp_SPc 51..288 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.