DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG5390

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:260 Identity:91/260 - (35%)
Similarity:134/260 - (51%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YFNYNQIRRETYGS-NPRA---TFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKY 80
            |.|.|.:..:..|: |..|   .|||::::|.:...|..|...|:||.|||||||||.::.....
  Fly   137 YQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPS 201

  Fly    81 DLVVRAGEWDTST-TADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYL 144
            .:|||||||||.| |..::|.|..|..|:.|||||:.:..|::|:::|.|.|.:..||..:.|..
  Fly   202 SIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPN 266

  Fly   145 QEAGIQKGSCFFNGWGK-VYLNSTDYPTVLKTVQVDLLSMGMCSS--RKLPIQQ--------ICG 198
            .........|:..|||| .:....:|..:||.|.:.::....|.:  |:..:.:        ||.
  Fly   267 VGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICA 331

  Fly   199 KGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLRL 262
            .|.:..| |.||||:||||.|.....::...|||.|.......|...|:.:||.|.||||..|::
  Fly   332 GGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDAKLKI 396

  Fly   263  262
              Fly   397  396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 84/232 (36%)
Tryp_SPc 39..256 CDD:214473 81/229 (35%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 83/237 (35%)
Tryp_SPc 153..390 CDD:214473 82/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.