DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and OVCH2

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:277 Identity:81/277 - (29%)
Similarity:129/277 - (46%) Gaps:42/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLVNSQYFNYNQIRRETYGSN--PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAH-ILN 75
            |||..|.:||..|.....|.:  .:.::||.|| |.||.   ::|..||:::|..|:|||| |.|
Human    40 SLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVS-LKQRQ---KHICGGSIVSPQWVITAAHCIAN 100

  Fly    76 GTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFN-RFNAENNMALLILVSAFEMTANINL 139
            ......|.|.|||:|.|.| |.....|.:..::.|..|: :...:.::|||.:..||:....:. 
Human   101 RNIVSTLNVTAGEYDLSQT-DPGEQTLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVG- 163

  Fly   140 IPLYLQ------EAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQ-IC 197
             |:.|.      |||.   .|...|||::..... ...||:.|.:.:|:...|.:..|.::: |.
Human   164 -PICLPELREQFEAGF---ICTTAGWGRLTEGGV-LSQVLQEVNLPILTWEECVAALLTLKRPIS 223

  Fly   198 GKGL-------EGID-CSGDGGAPLVCRILTYPYKYAQVGIVNW----------LSQKPVENTFI 244
            ||..       .|.| |.||.|..|:||.....:..|  |:.:|          ..:|..:.:..
Human   224 GKTFLCTGFPDGGRDACQGDSGGSLMCRNKKGAWTLA--GVTSWGLGCGRGWRNNVRKSDQGSPG 286

  Fly   245 VFTNVAGLLPWIDYHLR 261
            :||:::.:||||..|::
Human   287 IFTDISKVLPWIHEHIQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 72/246 (29%)
Tryp_SPc 39..256 CDD:214473 70/243 (29%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 71/255 (28%)
Tryp_SPc 56..301 CDD:238113 73/257 (28%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.