DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG40160

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:241 Identity:84/241 - (34%)
Similarity:118/241 - (48%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQ-QHVDL 102
            |||.|::|...:  ..|...||||:..|||||||.:.........||||||||.|..:: .:.:.
  Fly   176 FPWTVALLHSGN--LSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQER 238

  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVYLNS 166
            .|..::.|..:||.:...:.||:||.....:..:||:|.|..|:...|.| :||..||||....|
  Fly   239 SVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGS 303

  Fly   167 T-DYPTVLKTVQVDLLSMGMCSSR--------KLPIQQ--ICGKGLEGID-CSGDGGAPLVC-RI 218
            . .|.:::|.|.:.::....|.:|        |..:.:  ||..|..||| |.|||||||.| |.
  Fly   304 LGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRG 368

  Fly   219 LTYPYKYAQVGIVNW----LSQKPVENTFIVFTNVAGLLPWIDYHL 260
            .|...:|.|.|||.|    ..:.|.     .:.|||.:..|||..:
  Fly   369 STRESRYQQTGIVAWGIGCNDEVPA-----AYANVALVRGWIDQQM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 84/238 (35%)
Tryp_SPc 39..256 CDD:214473 81/235 (34%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 84/238 (35%)
Tryp_SPc 169..405 CDD:214473 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.