DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and prss60.3

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:272 Identity:78/272 - (28%)
Similarity:117/272 - (43%) Gaps:48/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTTLIISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAH 72
            |.|.|:..||               ::| .::||.|| |....:...:.| ||||:...||||||
Zfish    32 LNTRIVGGVN---------------ASP-GSWPWQVS-LHSPKYGGHFCG-GSLISSEWVLTAAH 78

  Fly    73 ILNGTTKYDLVVRAGE--------WDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVS 129
            .|:|.::..|||..|.        ::||....:..|         |..:|....:|::|||.|.|
Zfish    79 CLSGVSETTLVVYLGRRTQQGINIYETSRNVAKSFV---------HSSYNSNTNDNDIALLRLSS 134

  Fly   130 AFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVYLN-STDYPTVLKTVQVDLLSMGMCS----S 188
            |...|..|..:.|..|.:....| |.:..|||.:... :...|.:|:...:.:::...|:    |
Zfish   135 AVTFTNYIRPVCLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGS 199

  Fly   189 RKLPIQQICGKGLE--GID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVA 250
            ..:....||. ||.  |.| |.||.|.|:|.|:.|.   :.|.||.:|.......|:..|:|.|:
Zfish   200 GTVTNNMICA-GLTQGGKDTCQGDSGGPMVTRLCTV---WVQAGITSWGYGCADPNSPGVYTRVS 260

  Fly   251 GLLPWIDYHLRL 262
            ....||...:.|
Zfish   261 QYQSWISSKISL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 71/236 (30%)
Tryp_SPc 39..256 CDD:214473 69/233 (30%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 75/263 (29%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.