DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG18557

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:240 Identity:77/240 - (32%)
Similarity:118/240 - (49%) Gaps:18/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLE 103
            |||.|:::..   |..:.|.|:|:..|:|:||||::...|..|..:..|.||....|.:......
  Fly    95 FPWTVALMQN---LINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRT 156

  Fly   104 VLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI--QKGSCFFNGWGKVYLNS 166
            ...||||..||:....||:||::|.::|.|...|.  |:....:|:  .:..|...|||:....:
  Fly   157 ATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIG--PICWPTSGVSFDRERCLVAGWGRPDFLA 219

  Fly   167 TDYPTVLKTVQVDLLSMGMCSS--RKLPIQQ--------ICGKGLEGID-CSGDGGAPLVCRILT 220
            .:|....|.:.:.::|...|.|  |:....|        :|..|..|.| |.||||:||:|.|..
  Fly   220 KNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPG 284

  Fly   221 YPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLRLEAN 265
            :|..|..|||||......:||...::||::.:.|||:..|..|.|
  Fly   285 HPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDELN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 74/232 (32%)
Tryp_SPc 39..256 CDD:214473 72/229 (31%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 74/232 (32%)
Tryp_SPc 90..320 CDD:214473 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.