DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG1304

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:212 Identity:56/212 - (26%)
Similarity:91/212 - (42%) Gaps:53/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSLINPNVVLTAAHIL-----NGTT----KYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFN 114
            ||:::.|.||||||.:     ||.:    .....:|||..|..:..    |.::|..::.||::.
  Fly    59 GSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGG----VLVQVAEVIVHEEYG 119

  Fly   115 RFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVYLNSTDYPTVLKTVQV 178
            .|  .|::|||.|.|...::|:|.  |:.|..|..... ....:|||:: .:..|.|..|:...:
  Fly   120 NF--LNDVALLRLESPLILSASIQ--PIDLPTADTPADVDVIISGWGRI-KHQGDLPRYLQYNTL 179

  Fly   179 DLLSMGMCSSRKLPIQQICGKGLEG-------ID---CSGDGGAPLV---------------CRI 218
            ..:|:..|       .::.|.|::.       .|   |:||.|.|.|               |. 
  Fly   180 KSISLERC-------DELIGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACG- 236

  Fly   219 LTYPYKYAQVGIVN-WL 234
            .:||..||:|...| |:
  Fly   237 TSYPDGYARVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 56/212 (26%)
Tryp_SPc 39..256 CDD:214473 56/212 (26%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 55/210 (26%)
Tryp_SPc 32..256 CDD:238113 56/212 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.