DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP008996

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_552892.3 Gene:AgaP_AGAP008996 / 3291870 VectorBaseID:AGAP008996 Length:249 Species:Anopheles gambiae


Alignment Length:238 Identity:64/238 - (26%)
Similarity:108/238 - (45%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQ-HVDL 102
            :||.:|:...|...:.:....:|:|.|..:||||.::.....||::|.||:|.:...:.. :.:.
Mosquito    18 WPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDLALEEEPYGYQER 82

  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQE--AGIQKGSCFFNGWGKVYLN 165
            .|..:.||.||:....|.::|||..........||  ||:.:.|  ......:.|..|||::| .
Mosquito    83 RVQIVASHPQFDPRTFEYDLALLRFYEPVVFQPNI--IPVCVPENDENFIGRTAFVTGWGRLY-E 144

  Fly   166 STDYPTVLKTVQVDLLSMGMCSS--------RKLPIQQICG---KGLEGID-CSGDGGAPLVCRI 218
            ....|:||:.|.|.::...:|.:        ..:|...||.   ||  |.| |.||.|.|:|  |
Mosquito   145 DGPLPSVLQEVTVPVIENNICETMYRSAGYIEHIPHIFICAGWKKG--GYDSCEGDSGGPMV--I 205

  Fly   219 LTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
            .....::...|:::|.......|...|:|.::....||:..|:
Mosquito   206 QRTDKRFLLAGVISWGIGCAEPNQPGVYTRISEFRDWINQILQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 63/234 (27%)
Tryp_SPc 39..256 CDD:214473 61/231 (26%)
AgaP_AGAP008996XP_552892.3 Tryp_SPc 6..243 CDD:214473 61/231 (26%)
Tryp_SPc 7..246 CDD:238113 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.