DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPA14

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_552456.2 Gene:CLIPA14 / 3291432 VectorBaseID:AGAP011788 Length:281 Species:Anopheles gambiae


Alignment Length:121 Identity:47/121 - (38%)
Similarity:69/121 - (57%) Gaps:5/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGV----GSLINPNVVLTAAHILNGTTKYDLVVR 85
            :|..:..|.:....|||:::||.:.......:.|    .|||.|||||||||.:....|..|::|
Mosquito   161 RIEGQKDGESEYGEFPWMLAVLREERVADSNLNVYECGASLIAPNVVLTAAHCVFNKQKEQLLIR 225

  Fly    86 AGEWDTSTTAD-QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLI 140
            ||||||.|..: .||.|..|..:::||.||:.:..|::|||||...|::..|:..|
Mosquito   226 AGEWDTQTRNELYQHQDRRVAEVITHEAFNKASLANDVALLILTEPFQLAENVQPI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 45/107 (42%)
Tryp_SPc 39..256 CDD:214473 45/107 (42%)
CLIPA14XP_552456.2 Tryp_SPc 169..>281 CDD:304450 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.