DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and AgaP_AGAP004567

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_313871.5 Gene:AgaP_AGAP004567 / 3291034 VectorBaseID:AGAP004567 Length:321 Species:Anopheles gambiae


Alignment Length:245 Identity:70/245 - (28%)
Similarity:102/245 - (41%) Gaps:51/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFR---YIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQH- 99
            :||:|.:      |:|   |.| |||||...::||||.:...|...|:.:        ..|.:| 
Mosquito    96 YPWIVML------LYRGAFYCG-GSLINDRYIVTAAHCVLSFTPQQLLAK--------LYDVEHG 145

  Fly   100 --VDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI----QKGSCFFNG 158
              |...::.:..||:|:.....|::||:.|....|  |..:.||:.|..||.    |.|:..  |
Mosquito   146 EMVTRAIVKLYGHERFSLDTFNNDIALVKLQQPVE--AGGSFIPICLPVAGRSFAGQNGTVI--G 206

  Fly   159 WGKVYLNSTDYPTVLKTVQVDLLSMGMC-----SSRKLPIQQICGKGLEG--IDCSGDGGAPLVC 216
            |||:...|....  |:...|.::|...|     .:.::....:|....||  ..|.||.|.||..
Mosquito   207 WGKLANGSLSQG--LQKAIVPIISNMQCRKSSYRASRITDNMLCAGYTEGGRDACQGDSGGPLNV 269

  Fly   217 -----RILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261
                 |.|        ||||:|.......|...|:|.|...|.||..:.|
Mosquito   270 GDSNFREL--------VGIVSWGEGCARPNYPGVYTRVTRYLNWIKSNTR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/241 (29%)
Tryp_SPc 39..256 CDD:214473 67/238 (28%)
AgaP_AGAP004567XP_313871.5 Tryp_SPc 84..306 CDD:214473 67/238 (28%)
Tryp_SPc 85..309 CDD:238113 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.