DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CLIPB3

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_307750.3 Gene:CLIPB3 / 3290783 VectorBaseID:AGAP003249 Length:365 Species:Anopheles gambiae


Alignment Length:255 Identity:75/255 - (29%)
Similarity:118/255 - (46%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQR-DWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLV--VRAGEWDTSTTADQQH- 99
            |||...:..|: |..|.:...|||||...::||||.:....:...|  ||.||||.::..|.|: 
Mosquito   124 FPWTALIEFQKPDGSFGFHCGGSLINDRYIVTAAHCIKSIPRGWKVHRVRLGEWDLTSANDCQNE 188

  Fly   100 ------VDLEVLNIVSHEQF---NRFNAENNMALLILVSAFEMTANINLIPLYL-------QEAG 148
                  :||::..||.|..:   ::.|| |::||:........:..:..|.|.|       ..||
Mosquito   189 FCSDAPIDLDIEQIVVHTGYDTKDQSNA-NDIALIRFTRPVNYSQTVRPICLPLSSSLRNRNHAG 252

  Fly   149 IQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQ----------ICGKGLEG 203
            :   ..:..||||.. ::|.....|| |::::.|:..|:    |:.|          :|..|:.|
Mosquito   253 M---PAYAAGWGKTE-SATASEKKLK-VEMNIKSLQECA----PVYQRGGILLKKTHMCAGGVRG 308

  Fly   204 ID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQK------PVENTFIVFTNVAGLLPWI 256
            .| ||||.|.||:.::....|   .:|:|::..||      |.     |:||||..:.||
Mosquito   309 KDTCSGDSGGPLMRQMSGSWY---LIGVVSFGPQKCGAPGVPG-----VYTNVAEYVDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 75/255 (29%)
Tryp_SPc 39..256 CDD:214473 73/253 (29%)
CLIPB3XP_307750.3 CLIP 37..89 CDD:288855
Tryp_SPc 112..360 CDD:214473 73/253 (29%)
Tryp_SPc 113..363 CDD:238113 75/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.