DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG4653

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:278 Identity:74/278 - (26%)
Similarity:114/278 - (41%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIISLVNSQYFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILN 75
            |::.:|.......:::..|. ||.|.       |:..:|:.:  ::..|:||....:|||||.::
  Fly    14 LLVVIVTLGVVQSSRLPAEV-GSQPH-------SISLRRNGV--HVCGGALIREKWILTAAHCVS 68

  Fly    76 ---GTTKY---DLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNA--ENNMALLILVSAFE 132
               |...|   ...||.|.....|..  |.|.|.  .|:.|..::..:|  .|::|||.|.::..
  Fly    69 LGGGQQSYPAKSYNVRVGSIQRLTGG--QLVPLS--KIIIHTNYSSSDAVGSNDLALLELETSVV 129

  Fly   133 MTANINLIPLYLQE--AGIQKGSCFFNGWG----------------KVYLNSTDYPTVLKTVQVD 179
            :.||.|.|.|..:.  ||.|   ..|:|||                :..|:::|..|.|...|.|
  Fly   130 LNANTNPIDLATERPAAGSQ---IIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQED 191

  Fly   180 LLSMGMCSSRKLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNWL-----SQKPV 239
            ||    |.|   |:.:    ...|: ||||.|||.       .|....|||..:.     |::|.
  Fly   192 LL----CLS---PVDE----DFAGL-CSGDAGAPA-------SYNNQLVGIAAFFVSGCGSEQPD 237

  Fly   240 ENTFIVFTNVAGLLPWID 257
            .     :.:|...|.||:
  Fly   238 G-----YVDVTQHLEWIN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/250 (27%)
Tryp_SPc 39..256 CDD:214473 66/247 (27%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 72/262 (27%)
Tryp_SPc 30..249 CDD:214473 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.