DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and gd

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:288 Identity:51/288 - (17%)
Similarity:97/288 - (33%) Gaps:87/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAH---ILNGT-TKYDLVVRAGEWDTSTTAD 96
            |.::||:.::.........:...|||::..||:::||   :.|.. |..:::|..|..:.....:
  Fly   259 RGSWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNE 323

  Fly    97 QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSC------- 154
            :..:...|..|..|..||...:..:..:.:::...|:..|     .:::.|.:..||.       
  Fly   324 EGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFN-----TFIRPACLWSGSSKTEYIVG 383

  Fly   155 ---FFNGW------------------GKVYLNSTDYPTVLKTVQVDLLSMGMC-----SSRKLPI 193
               ...||                  ||   .||| .:..|.|:..::....|     ..|.|..
  Fly   384 ERGIVIGWSFDRTNRTRDQKLSSELPGK---KSTD-ASAPKVVKAPIVGNAECFRANAHFRSLSS 444

  Fly   194 QQICGKGLEGID----------CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPV--------- 239
            .:....|::..:          .:|..||.|..|...           .|:.:..|         
  Fly   445 NRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRNN-----------RWMLRGTVSAALPAVET 498

  Fly   240 -----------ENTFIVFTNVAGLLPWI 256
                       :|.:|::.:||..|.||
  Fly   499 PDAESSHKLCCKNQYIIYADVAKFLDWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 50/285 (18%)
Tryp_SPc 39..256 CDD:214473 48/283 (17%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 49/286 (17%)
Tryp_SPc 258..526 CDD:214473 49/286 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.