DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG31827

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:279 Identity:94/279 - (33%)
Similarity:130/279 - (46%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLIISL----VNSQYFNYNQIRRETYG-SNPRAT---------------FPWVVSVLDQRDWLFR 54
            |||::|    |.....|..||.....| .||.|.               |||.::|:..|.    
  Fly     6 TLIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRS---- 66

  Fly    55 YIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQ-QHVDLEVLNIVSHEQFNRFNA 118
            .:|.||||.|::||||||.:......|:||.||||:..:..:: ...:..||.:|.|:.||....
  Fly    67 LVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRG 131

  Fly   119 ENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSM 183
            .||:|||.|...|.:|..||.|.|..|:..:....|...||||...:.|.|..|||.:.:.::..
  Fly   132 ANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPR 196

  Fly   184 GMCSS--RK--------LPIQQICGKGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQK 237
            .:|..  ||        ||...||..|.:..| |:||||..|.|.:...|.::.|:|||||....
  Fly   197 HICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGC 261

  Fly   238 PVENTFIVFTNVAGLLPWI 256
            ..:|....:|:|....|||
  Fly   262 KEKNVPATYTDVFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 82/230 (36%)
Tryp_SPc 39..256 CDD:214473 80/228 (35%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 82/235 (35%)
Tryp_SPc 50..280 CDD:214473 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.