DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG32376

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:228 Identity:58/228 - (25%)
Similarity:83/228 - (36%) Gaps:70/228 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LINPNVVLTAAHILNG-TTKYDLVVRAGEWDTSTTADQQ-------HVDLEVLNIVSHEQFNRFN 117
            :||...:|||.|...| ..||  .||.|       :|||       ||.    .||:...:|.:.
  Fly    95 IINKIWILTAHHCFFGPPEKY--TVRVG-------SDQQRRGGQLRHVK----KIVALAAYNDYT 146

  Fly   118 AENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSC------------------FFNGWGKVYL 164
            ..:::|::.|.|           |:|.       |.|                  ..:|||....
  Fly   147 MRHDLAMMKLKS-----------PVYF-------GKCVRPVKLPSTKTTKFPKKFVVSGWGITSA 193

  Fly   165 NSTDYPTVLKTVQVDLLSMGMC------SSRKLPIQQICGKGLEGIDCSGDGGAPLVCRILTYPY 223
            |:.:....|:.||:|.:....|      :..|:....||........||||.|.||..|.:.|  
  Fly   194 NAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVLY-- 256

  Fly   224 KYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
                 |||:|......:|...|:.|....:|||
  Fly   257 -----GIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 58/228 (25%)
Tryp_SPc 39..256 CDD:214473 56/226 (25%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 56/226 (25%)
Tryp_SPc 66..287 CDD:238113 58/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.