DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:245 Identity:69/245 - (28%)
Similarity:106/245 - (43%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNG-TTKYDLVVRAGEWDTSTTADQQHVDL 102
            |||.||:.:..:   .:.| .::|....:::|||..|. ........:||....| .::...|..
  Rat   250 FPWQVSLRENHE---HFCG-ATIIGARWLVSAAHCFNEFQDPAQWAAQAGSVHLS-GSEASAVRA 309

  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPL----YLQEAGI--------QKGSCF 155
            .||.|..|..:|...|:.::|:|.|..           ||    |:|.|.:        .:..|.
  Rat   310 RVLRIAKHPAYNADTADFDVAVLELAR-----------PLPFGRYVQPACLPAATHVFPPRKKCL 363

  Fly   156 FNGWGKVYLNSTDY---PTVLKTVQVDLLSMGMCSS---RKLPIQQICGKGLEG-ID-CSGDGGA 212
            .:|||  ||.. |:   |.||:...|:||...:|||   ..|..:.:|...|:| :| |.||.|.
  Rat   364 ISGWG--YLKE-DFLVKPEVLQKATVELLDQNLCSSLYGHSLTDRMVCAGYLDGKVDSCQGDSGG 425

  Fly   213 PLVCRILTYPY-KYAQVGIVNW-----LSQKPVENTFIVFTNVAGLLPWI 256
            ||||.   .|. ::...|:|:|     .:::|.     |:|.|..|..||
  Rat   426 PLVCE---EPSGRFFLAGVVSWGIGCAEARRPG-----VYTRVTRLRDWI 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/245 (28%)
Tryp_SPc 39..256 CDD:214473 67/243 (28%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.