DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:265 Identity:75/265 - (28%)
Similarity:107/265 - (40%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GSNPR---------ATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDL----- 82
            |.:||         ..:||.||:..|.   :...| ||:|.|..::||||.:     |||     
  Rat   212 GYSPRIVGGNVSSLTQWPWQVSLQFQG---YHLCG-GSVITPLWIVTAAHCV-----YDLYHPKS 267

  Fly    83 -VVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQE 146
             .|:.|......:....|:   |..|:.|.::......|::||:.|.........|..|.|...|
  Rat   268 WTVQVGLVSLMDSPVPSHL---VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSE 329

  Fly   147 AGIQKGS-CFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRK-----LPIQQICGKGLE-GI 204
            .....|. |:.:|||.....:.|...||....|.|:|..:|:.|.     :....:|...|: |:
  Rat   330 ENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGGV 394

  Fly   205 D-CSGDGGAPLVC--RILTYPYKYAQVGI----VNWLSQKPVENTFIVFTNVAGLLPWIDYHLRL 262
            | |.||.|.||||  |.|.........||    ||    ||.     |:|.:...|.||  |.:|
  Rat   395 DSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVN----KPG-----VYTRITSFLDWI--HEQL 448

  Fly   263 EANFR 267
            |.:.:
  Rat   449 ERDLK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/239 (29%)
Tryp_SPc 39..256 CDD:214473 67/236 (28%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055
Tryp_SPc 216..444 CDD:214473 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.