DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Ovch2

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:126/274 - (45%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLVNSQYFNYNQIRRETYGSN--PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHIL-N 75
            |||.....||..:.....|.:  .:.::||.||:..::    ::|..|::|:...|:||||.: |
  Rat    36 SLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQKQ----KHICGGTIISSQWVITAAHCMAN 96

  Fly    76 GTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAEN-NMALLILVSAFEMTANINL 139
            ......|.|.|||.|.| .|:.....|.:..|:.|.||:.....| ::|||.:|..|:....:. 
  Rat    97 RNIALTLNVTAGEHDLS-QAEPGEQTLAIETIIIHPQFSTKKPMNYDIALLKMVGTFQFGQFVR- 159

  Fly   140 IPLYLQEAGIQKGS---CFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSRKLPIQQ-ICGKG 200
             |:.|.|.|.|..:   |...|||:: ......|.||:.|.:.:|:...|.:..|.::. |.||.
  Rat   160 -PVCLPEPGEQFNAGYICTTAGWGRL-SEGGSLPQVLQQVNLPILTHEECEAVMLTLRNPITGKT 222

  Fly   201 L-------EGID-CSGDGGAPLVCRILTYPYKYAQVGIVNW----------LSQKPVENTFIVFT 247
            .       .|.| |.||.|..|:|:.....:..|  |:.:|          .::|..:.:..:||
  Rat   223 FLCTGSPDGGRDACQGDSGGSLMCQNRKGAWTLA--GVTSWGLGCGRSWRNNARKKEQGSPGIFT 285

  Fly   248 NVAGLLPWIDYHLR 261
            ::..:||||..|::
  Rat   286 DLRRVLPWIHEHVQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/243 (28%)
Tryp_SPc 39..256 CDD:214473 67/240 (28%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 70/254 (28%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.