DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:254 Identity:63/254 - (24%)
Similarity:96/254 - (37%) Gaps:65/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLE 103
            :||..|:..|:    .::..|||::|..||||||..:|               |..:....|.|.
  Rat    41 WPWQASLRLQK----VHVCGGSLLSPEWVLTAAHCFSG---------------SVNSSDYEVHLG 86

  Fly   104 VLNIVSHEQFNRF-------------NAENNMALLILVSAFEMTANINLIPLYLQEA------GI 149
            .|.|.....|:..             .:..::||:.|.:...:::.:.  |:.|.||      |:
  Rat    87 ELTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVALSSQVQ--PVCLPEASADFHPGM 149

  Fly   150 QKGSCFFNGWGKVYLNSTDYP------TVLKTVQVDLLSMGMCSSRKLPIQ--QICGKGLEGIDC 206
            |   |:..|||.........|      ..:..|.|:..|....||....||  .:|..| .|..|
  Rat   150 Q---CWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQSDMLCAWG-PGDAC 210

  Fly   207 SGDGGAPLVCRILTYPYKYAQVGIVNW-----LSQKPVENTFIVFTNVAGLLPWIDYHL 260
            ..|.|.|||||:...   :.|.|:|:|     ...:|.     |:..|...:.||..|:
  Rat   211 QDDSGGPLVCRVAGI---WQQAGVVSWGEGCGRPDRPG-----VYARVTAYVNWIHRHI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 62/251 (25%)
Tryp_SPc 39..256 CDD:214473 60/248 (24%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 60/248 (24%)
Tryp_SPc 30..260 CDD:238113 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.