DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss22

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:252 Identity:55/252 - (21%)
Similarity:111/252 - (44%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QIRRETYGSNPR-ATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGT----TKYDLVV 84
            |:.|...|.:.. |.:||:||:|....    :...|||:....|::|||..:..    :.|.:::
  Rat    46 QLNRVVGGEDSADAQWPWIVSILKNGS----HHCAGSLLTNRWVVSAAHCFSSNMDKPSPYSVLL 106

  Fly    85 RAGEWDTSTTADQQHVDLEVLNIVSHEQFNRFNAEN-NMALLILVSAFEMTANINLIPLYLQEAG 148
              |.|.......:.. .:.:.:::.|.:::|....: ::||:.|....:.:..|  :|:.|.::.
  Rat   107 --GAWKLGNPGPRSQ-KVGIASVLPHPRYSRKEGTHADIALVRLERPIQFSERI--LPICLPDSS 166

  Fly   149 IQ---KGSCFFNGWGKVYLN-STDYPTVLKTVQVDLLSMGMCSS--------RKLPIQQICGKGL 201
            :.   ..:|:..|||.:... ....|..|:.::|.::...:|.|        ..:....:|...|
  Rat   167 VHLPPNTNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGYL 231

  Fly   202 EG--IDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            ||  ..|.||.|.||:|::..:   :...||::|.......|...|:|::....||:
  Rat   232 EGKRDACLGDSGGPLMCQVDDH---WLLTGIISWGEGCAERNRPGVYTSLLAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 51/237 (22%)
Tryp_SPc 39..256 CDD:214473 50/235 (21%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 53/247 (21%)
Tryp_SPc 50..288 CDD:238113 53/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.