DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:239 Identity:65/239 - (27%)
Similarity:103/239 - (43%) Gaps:34/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQ--QHVD 101
            :||.||:..:..:...:.| ||||:|..||||||.:.      |.:::.|.......:|  .:.|
  Rat    41 WPWQVSLRFKFSFWMHFCG-GSLIHPQWVLTAAHCVG------LHIKSPELFRVQLREQYLYYAD 98

  Fly   102 --LEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVY 163
              |.|...|.|..:.......::|||.|.:...::.:|:...|.........| ||:..|||.: 
  Rat    99 QLLTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDI- 162

  Fly   164 LNSTDYPTV----LKTVQVDLLSMGMCSSR---------KLPIQQ---ICGKGLEGIDCSGDGGA 212
              .:|.|.:    ||.|:|.::...:|..:         .:||.|   :|........|.||.|.
  Rat   163 --DSDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAGNTRSDSCQGDSGG 225

  Fly   213 PLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            ||||::   ...:.|.|:|:|.......|...::|.|...|.||
  Rat   226 PLVCKV---KGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 65/239 (27%)
Tryp_SPc 39..256 CDD:214473 63/237 (27%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 65/239 (27%)
Tryp_SPc 30..266 CDD:214473 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.