DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss34

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:294 Identity:78/294 - (26%)
Similarity:118/294 - (40%) Gaps:64/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYFAFLTTLIISLVNSQYFNYNQIRRETYGSNP--RATFPWVVSV----LDQRDWLFRYIGVGSL 61
            |:|.|||...:........:..|......|..|  .:.|||.||:    :....|  .:|..|||
  Rat     6 LWFLFLTLPCLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKW--EHICGGSL 68

  Fly    62 INPNVVLTAAHILNGTTKYDLVVRAGEWDTST-----------TADQQHVDLEVLNIVSHEQFN- 114
            |:|..||||||          .|...|.:.|.           ..||.   ::|..|:.|.:|: 
  Rat    69 IHPQWVLTAAH----------CVELKEMEASCFRVQVGQLRLYENDQL---MKVAKIIRHPKFSE 120

  Fly   115 RFNAEN--NMALLILVSAFEMTANINLIPLYLQEAGI-QKGSCFFNGWGKVY-LNSTDYPTVLKT 175
            :.:|..  ::|||.|.|...::..::.:.|......| .|.:.:..|||.:. ......|..|:.
  Rat   121 KLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLRE 185

  Fly   176 VQVDLLSMGMC------------SSRKLPIQQICGKGLEGID-CSGDGGAPLVCRILTYPYKYAQ 227
            |.|.::....|            :::.:....:|. |:||.| |..|.|.|||||   :...:.|
  Rat   186 VAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCA-GMEGRDSCQADSGGPLVCR---WNCSWVQ 246

  Fly   228 VGIVNW-----LSQKPVENTFIVFTNVAGLLPWI 256
            ||:|:|     |...|.     |:|.|...|.||
  Rat   247 VGVVSWGIGCGLPDFPG-----VYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 70/256 (27%)
Tryp_SPc 39..256 CDD:214473 68/254 (27%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 72/267 (27%)
Tryp_SPc 33..275 CDD:214473 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.