DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Prss29

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:255 Identity:71/255 - (27%)
Similarity:114/255 - (44%) Gaps:50/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNPRATFPWVVSVLDQR----DWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTST 93
            |.|:..:||.||:...|    .|:  :|..||:|:|..||||||.::            |.|...
  Rat    36 SAPQGKWPWQVSLRVYRYNWASWV--HICGGSIIHPQWVLTAAHCIH------------ESDADP 86

  Fly    94 TADQQHVD----------LEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAG 148
            :|.:.::.          |:|..::.|..|.|....:::|||.|..:.....|:.  |:.|..|.
  Rat    87 SAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVK--PVKLSPAS 149

  Fly   149 IQ---KGSCFFNGWGKVYLN-STDYPTVLKTVQVDLLSMGMCS------------SRKLPIQQIC 197
            ::   |..|:..|||.|.:: |...|..|:.|||.::...:|.            .::|.:|.:.
  Rat   150 LEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDML 214

  Fly   198 GKGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256
            ..|..|.| |.||.|.||||.:..   .:..||:|:|.....:::...|:..|...||||
  Rat   215 CAGSHGRDSCYGDSGGPLVCNVTG---SWTLVGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 69/249 (28%)
Tryp_SPc 39..256 CDD:214473 67/247 (27%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.