DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and LOC286960

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:269 Identity:72/269 - (26%)
Similarity:114/269 - (42%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLYFAFLTTLIISLVNSQ------YFNYNQIRRETYGSNPRATFPWVVSVLDQRDWLFRYIGVG 59
            :|::||||...:...||..      |            :.|:...|:.||:   .|.:....| |
  Rat     3 ISIFFAFLGAAVALPVNDDDKIVGGY------------TCPKHLVPYQVSL---HDGISHQCG-G 51

  Fly    60 SLINPNVVLTAAHILNGTTKYDLVVRAGEWDTST-TADQQHVDLEVLNIVSHEQFNRFNAENNMA 123
            |||:...||:|||..    |..|.||.||.:... ...:|.:|.|  .|:.|.::|:...:|::.
  Rat    52 SLISDQWVLSAAHCY----KRKLQVRLGEHNIHVLEGGEQFIDAE--KIIRHPEYNKDTLDNDIM 110

  Fly   124 LLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSS 188
            |:.|.|...:.:.::.:.| .:........|..:|||........||.:|:.::..:||...|..
  Rat   111 LIKLKSPAVLNSQVSTVSL-PRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKK 174

  Fly   189 R---KLPIQQICGKGLEG--IDCSGDGGAPLVCRILTYPYKYAQV-GIVNWLSQKPVENTFIVFT 247
            .   ::.....|...|||  ..|.||.|.|:||.        .:: |||:|.|...:.....|:|
  Rat   175 SYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCN--------GEIQGIVSWGSVCAMRGKPGVYT 231

  Fly   248 NVAGLLPWI 256
            .|...|.||
  Rat   232 KVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 63/225 (28%)
Tryp_SPc 39..256 CDD:214473 61/223 (27%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 63/247 (26%)
Tryp_SPc 24..243 CDD:238113 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.