DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG33459

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:285 Identity:80/285 - (28%)
Similarity:121/285 - (42%) Gaps:47/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YFAFLTTLIISLVNSQYF---------NYNQI--RRETYGSNPR--ATFPWVVSVLDQRDWLFRY 55
            |.::|  |:.|::.:|..         |..||  |...:|....  .:.||:..:.:.    .::
  Fly     3 YISYL--LVSSIIANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNH----LQF 61

  Fly    56 IGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTAD-----QQHVDLEVLNIVSHEQFNR 115
            :..||||....||||||.:..|.| :|.||.||:|.:...|     .:|.:..|..|.:|..: |
  Fly    62 LCGGSLITSEFVLTAAHCVMPTPK-NLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-R 124

  Fly   116 FNAENNMALLILVSAFEMTANINLIPLYLQE---------AGIQKGSCFFNGWGKVYLNSTDYPT 171
            ..|..::|||.|....|.|..|..|.|.|.|         ..::..:  ..|||..  .:.....
  Fly   125 SIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFT--LTGWGAT--KTEPVSQ 185

  Fly   172 VLKTVQVDLLSMGMCSSR---KLPIQQICGKGLEGIDCSGDGGAPLVCRIL-TYPYKYAQVGIVN 232
            ||::..:..:..|.|..|   .:....||....:...|.||.|:||..::: ...|.:|||||| 
  Fly   186 VLQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIV- 249

  Fly   233 WLSQKPVE-NTFIVFTNVAGLLPWI 256
              |:.|.. :...|||||.....||
  Fly   250 --SRGPKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 70/237 (30%)
Tryp_SPc 39..256 CDD:214473 68/235 (29%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 69/247 (28%)
Tryp_SPc 38..272 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.