DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Sp212

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:112/239 - (46%) Gaps:18/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQH 99
            ||..:||:.:|..:......:...||||:.::|::|||.::..|:..:||..|.:|.....:...
  Fly   284 PRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGA 348

  Fly   100 VDLEVLNIVSHEQFN-RFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSC-FFNGWGKV 162
            ....|:.::.|..:| |..::.::||:.:.........|..|.::..||.....:. |..|||:.
  Fly   349 EMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRD 413

  Fly   163 YLNS-TDYPTVLKTVQVDLLSMGMCSS----RKLPIQQICGKGLEGI-DCSGDGGAPLVCRILTY 221
            ..:| |.||.|   |:.::.|..:|:|    ..:..:.:|....:|. .|.||.|..|:.:   .
  Fly   414 EDSSRTQYPRV---VEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVK---Q 472

  Fly   222 PYKYAQVGIVNWLSQKPVE----NTFIVFTNVAGLLPWIDYHLR 261
            ..::...|||:...:.|..    |.::::.:::..:.||..::|
  Fly   473 GDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 53/231 (23%)
Tryp_SPc 39..256 CDD:214473 51/228 (22%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 55/235 (23%)
Tryp_SPc 277..511 CDD:214473 53/232 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.