DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:260 Identity:61/260 - (23%)
Similarity:102/260 - (39%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQH 99
            |..|:||..|:...:    .::..|||::|..||||||..:|               |..:....
Mouse    94 PAGTWPWQASLRLHK----VHVCGGSLLSPEWVLTAAHCFSG---------------SVNSSDYQ 139

  Fly   100 VDLEVLNIVSHEQFNRF-------------NAENNMALLILVSAFEMTANINLIPLYLQEA---- 147
            |.|..|.:.....|:..             .:..::||:.|.|...:::.:.  |:.|.||    
Mouse   140 VHLGELTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQ--PVCLPEASADF 202

  Fly   148 --GIQKGSCFFNGWGKVYLNSTD---YPTVLKTVQVDLLSMGMCS-------SRKLPIQQICGKG 200
              |:|   |:..|||  |....:   .|..|:..:|.::.:..||       ...:....:|.:|
Mouse   203 YPGMQ---CWVTGWG--YTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARG 262

  Fly   201 LEGIDCSGDGGAPLVCRILTYPYKYAQVGIVNW-----LSQKPVENTFIVFTNVAGLLPWIDYHL 260
             .|..|..|.|.||||::..   .:.|.|:|:|     ...:|.     |:..|...:.||.:|:
Mouse   263 -PGDACQDDSGGPLVCQVAG---TWQQAGVVSWGEGCGRPDRPG-----VYARVTAYVNWIHHHI 318

  Fly   261  260
            Mouse   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 58/253 (23%)
Tryp_SPc 39..256 CDD:214473 56/250 (22%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 60/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.