DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and TPSG1

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:244 Identity:66/244 - (27%)
Similarity:105/244 - (43%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRATFPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGT-TKYDLVVRAGEWDTSTTADQQ 98
            |...:||..|:..:|    .::..|||::|..||||||..:|: ...|..|..||.:.:.:   .
Human    70 PAGAWPWQASLRLRR----VHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLS---P 127

  Fly    99 HVDLEVLNIVSHEQ-FNRFNAENNMALLILVSAFEMTANINLIPLYLQEA------GIQKGSCFF 156
            |.. .|..|:.|.. ..:.....::||:.|  :..:|.:..::|:.|.||      ||:   |:.
Human   128 HFS-TVRQIILHSSPSGQPGTSGDIALVEL--SVPVTLSSRILPVCLPEASDDFCPGIR---CWV 186

  Fly   157 NGWGKVYLNSTD---YPTVLKTVQVDLLSMGMC-------SSRKLPIQQICGKGLEGIDCSGDGG 211
            .|||  |....:   .|..|:.|:|.::....|       ....|....:|.:| .|..|..|.|
Human   187 TGWG--YTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARG-PGDACQDDSG 248

  Fly   212 APLVCRILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHL 260
            .||||::   ...:.|.|.|:|.......|...|:|.|...:.||..|:
Human   249 GPLVCQV---NGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/237 (27%)
Tryp_SPc 39..256 CDD:214473 62/234 (26%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 63/238 (26%)
Tryp_SPc 63..293 CDD:238113 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.