DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Plau

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:217 Identity:63/217 - (29%)
Similarity:94/217 - (43%) Gaps:19/217 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GSLINPNVVLTAAH-ILNGTTKYDLVVRAGEWDTSTTADQQHVDLEVLNIVSHEQFN--RFNAEN 120
            ||||:|..|.:|.| .:|...|.:.||..|: ....:.:...:..||..::.||.|:  .....|
  Rat   212 GSLISPCWVASATHCFVNQPKKEEYVVYLGQ-SKRNSYNPGEMKFEVEQLILHEDFSDETLAFHN 275

  Fly   121 NMALLILVSAFEMTA----NINLIPLYLQEAGIQKGS-CFFNGWGKVYLNSTDYPTVLKTVQVDL 180
            ::|||.:.::....|    .|..|.|..:......|| |...|:|:.......||..||...|.:
  Rat   276 DIALLKIRTSTGQCAQPSRTIQTICLPPRFGDAPFGSDCEITGFGQESATDYFYPKDLKMSVVKI 340

  Fly   181 LSMGMCS-----SRKLPIQQICGKGLE--GIDCSGDGGAPLVCRILTYPYKYAQVGIVNWLSQKP 238
            :|...|.     ..::..:.:|....|  ...||||.|.||:|.|...|   ...|||:|.|...
  Rat   341 ISHEQCKQPHYYGSEINYKMLCAADPEWKTDSCSGDSGGPLICNIDGRP---TLSGIVSWGSGCA 402

  Fly   239 VENTFIVFTNVAGLLPWIDYHL 260
            .:|...|:|.|:..|.||..|:
  Rat   403 EKNKPGVYTRVSYFLNWIQSHI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 62/214 (29%)
Tryp_SPc 39..256 CDD:214473 60/211 (28%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056
Connecting peptide 152..178
Tryp_SPc 178..420 CDD:214473 60/211 (28%)
Tryp_SPc 179..423 CDD:238113 62/214 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.