DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and Proc

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_008770240.3 Gene:Proc / 25268 RGDID:3411 Length:500 Species:Rattus norvegicus


Alignment Length:237 Identity:68/237 - (28%)
Similarity:111/237 - (46%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQHVDLEV 104
            ||...:||.:..|  ..| |.||:.:.||||||.|..:.|  |.||.||:|. ...|...:||::
  Rat   264 PWQAILLDSKKKL--ACG-GVLIHTSWVLTAAHCLESSKK--LTVRLGEYDL-RRRDPWELDLDI 322

  Fly   105 LNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGI-----QKG-SCFFNGWG--- 160
            ..::.|..:.|.|::|::|||.|  :...|.:..::|:.|..:|:     |.| .....|||   
  Rat   323 KEVLVHPNYTRSNSDNDIALLRL--SQPATLSKTIVPICLPNSGLAQELSQAGQETVVTGWGYQS 385

  Fly   161 -KVYLNSTDYPTVLKTVQVDLLSMGMC---SSRKLPIQQICGKGLEGID---CSGDGGAPLVCRI 218
             ||.....:...:|..:::.|.:...|   .:..:....:|. |:.|..   |.||.|.|:|   
  Rat   386 DKVKDGRRNRTFILTFIRIPLAARNDCMQVMNNVVSENMLCA-GIIGDTRDACDGDSGGPMV--- 446

  Fly   219 LTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHL 260
            :.:...:..||:|:|.......|.:.|:|.|...|.||..::
  Rat   447 VFFRGTWFLVGLVSWGEGCGHLNNYGVYTKVGSYLKWIHSYI 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 68/234 (29%)
Tryp_SPc 39..256 CDD:214473 66/231 (29%)
ProcXP_008770240.3 GLA 65..125 CDD:214503
EGF_CA 126..170 CDD:238011
FXa_inhibition 178..213 CDD:405372
Tryp_SPc 252..486 CDD:238113 68/233 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.