DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4259 and CG30375

DIOPT Version :9

Sequence 1:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:239 Identity:59/239 - (24%)
Similarity:103/239 - (43%) Gaps:57/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVR----AGEWDTSTTADQQH 99
            ||.:|.:.|....|..:.| ||:::...::||||.   |.:..:..|    .||.|.||.|:..:
  Fly   163 FPSMVGLRDLSSNLPIFCG-GSIVSERYIMTAAHC---TARQPVASRLLALVGEHDLSTGAESIY 223

  Fly   100 -VDLEVLNIVSHEQFNRFNAE--NNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFN---- 157
             ....:.||::|..:....:.  |::|||...:..|.:..:..|.|.:::|   :.|  ||    
  Fly   224 AAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSRGVAPICLPIRQA---ENS--FNYQNV 283

  Fly   158 ---GWGKVYLNSTDYPTVLKTVQVDLLSM--GMCSSR---KLPIQQIC-----GKGLEGIDCSGD 209
               |||.:...::...|:.|..   ||:|  .:|.||   .:....:|     |:|.:  .|..|
  Fly   284 DIMGWGTLGFAASKSNTLQKAT---LLTMDNAVCRSRFNSSITPSHLCTYDAGGRGQD--SCQYD 343

  Fly   210 GGAPLVCR---------ILTYPYKYAQ---VGI-------VNWL 234
            .|.|::.|         :::|.....|   :|:       :|||
  Fly   344 SGGPVILRQRERMFQLGVISYGRACGQPFGIGVNTRVTSHLNWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 59/239 (25%)
Tryp_SPc 39..256 CDD:214473 59/239 (25%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 56/236 (24%)
Tryp_SPc 152..387 CDD:238113 57/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.